PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016476239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 427aa    MW: 49484.6 Da    PI: 9.4038
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016476239.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.42.1e-121594898
                    -HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  8 sdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                       +k+g l +p  f+ ++  g++   +++  +  + +++W+vk+  ++++    ++ GW +F+++++L+ gD ++F+++g++ f   v +f+
  XP_016476239.1 15 QPGFKNG-LKIPTGFL-KYlkGYD---HIEHAILRRGSKQWRVKV--NGCR----FEVGWADFAQQHDLQLGDLLIFRHEGNMVF--EVIIFD 94
                    4455665.********.6655444...567788899*********..7777....999*********************999999..777776 PP

2B351.51.8e-16138220488
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.S CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.s 88 
                      +++s++l++g +++p +fa+++g++ ++  +l+++de+ rsW++kl    + +++++++ W +F  an+Lk+gD + F+++ + +
  XP_016476239.1 138 CTVRSYYLTNGYMRVPSRFASKNGLIYKK-CDLIIRDERQRSWNLKL--YTSCDHVYIGGRWAKFHAANDLKVGDRIKFEVVTNgE 220
                     5678*******************998655.59***************..99999**************************876523 PP

3B343.27.1e-14326412595
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +++++ l+ + l+lp +fa ++g+++ ++ +l+++de+ rsW++ l  r  + ++ +++GW++  + + LkegD ++F+++  +++++v k
  XP_016476239.1 326 TIRPYCLTYSYLILPTQFALTNGLIN-KKYDLIIRDEWQRSWNLML--RPFGTSVCIRGGWSKLRDTHCLKEGDQIMFEVVT-DGTKPVWK 412
                     56788999999***********9995.668****************..*******************************876.56656655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.4E-19498IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-19498IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.138796IPR003340B3 DNA binding domain
CDDcd100174.33E-13894No hitNo description
SMARTSM010191.3E-121096IPR003340B3 DNA binding domain
PfamPF023624.6E-91894IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-16133226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-17134229IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.406135229IPR003340B3 DNA binding domain
SMARTSM010191.7E-8136230IPR003340B3 DNA binding domain
PfamPF023621.1E-14139221IPR003340B3 DNA binding domain
CDDcd100171.46E-13141230No hitNo description
Gene3DG3DSA:2.40.330.102.5E-14319413IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-16321414IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.743322416IPR003340B3 DNA binding domain
SMARTSM010198.9E-12323417IPR003340B3 DNA binding domain
PfamPF023627.9E-12326412IPR003340B3 DNA binding domain
CDDcd100176.86E-11337410No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MRVPPKKPHF FKPIQPGFKN GLKIPTGFLK YLKGYDHIEH AILRRGSKQW RVKVNGCRFE  60
VGWADFAQQH DLQLGDLLIF RHEGNMVFEV IIFDSSHCDR EYAEYLLQEE DIVEEACKKF  120
KFKEAATHNP FGQSHFECTV RSYYLTNGYM RVPSRFASKN GLIYKKCDLI IRDERQRSWN  180
LKLYTSCDHV YIGGRWAKFH AANDLKVGDR IKFEVVTNGE RPIWKFHVKR NPSIKSSSKA  240
FPYAEAATHK PFGPSHLDSG HCNREYAEYL QEKEEEKEEA AGDAVEGTSK KFKLKEEPNP  300
SVKSSSKAFP HVEAAIHKPF GHFVCTIRPY CLTYSYLILP TQFALTNGLI NKKYDLIIRD  360
EWQRSWNLML RPFGTSVCIR GGWSKLRDTH CLKEGDQIMF EVVTDGTKPV WKFHGKISGE  420
CKNQSRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016476239.10.0PREDICTED: B3 domain-containing protein REM5-like isoform X2
TrEMBLK4CIB31e-139K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.11e-138(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.12e-36B3 family protein